- DNA helicase HEL308 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91842
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Immunogen affinity purified
- Human
- DNA helicase HEL308
- IgG
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: ECLVLGGGDT NPDLLRHMPT DRGVGDQPND SEVDMFGDYD SFTENSFIAQ VDDLEQKYMQ LPEHKKHATD FATENLCSE
- Novus Biologicals, a Bio-Techne Brand
- helicase, POLQ like
- HEL308
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKHATDFATENLCSE
Specifications/Features
Available conjugates: Unconjugated